Recombinant Human Monoacylglycerol Lipase protein (ab101045)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMETGPEDPSSMPEESSPRRTPQSIPYQDLP HLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDL LVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLG HSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLV LPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRV ERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHV LHKELPEVTNSVFHEINMWVSQRTATAGTASPP
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 333
    • Tags
      His tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab101045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    purified by using conventional chromatography
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: 0% None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • EC 3.1.1.23
    • HU K5
    • HU-K5
    • HUK5
    • Lysophospholipase homolog
    • Lysophospholipase like
    • Lysophospholipase-like
    • MAGL
    • MGL
    • MGLL
    • MGLL_HUMAN
    • Monoacylglycerol lipase
    • Monoglyceride lipase
    see all
  • Function
    Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain (By similarity). Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth.
  • Tissue specificity
    Detected in adipose tissue, lung, liver, kidney, brain and heart.
  • Pathway
    Glycerolipid metabolism; triacylglycerol degradation.
  • Sequence similarities
    Belongs to the AB hydrolase superfamily. Monoacylglycerol lipase family.
  • Information by UniProt

Recombinant Human Monoacylglycerol Lipase protein images

  • ab101045 at 3 µg being analysed by 15% SDS PAGE.

References for Recombinant Human Monoacylglycerol Lipase protein (ab101045)

ab101045 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up