Recombinant Human Motilin protein (ab116979)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP12872
    • SpeciesHuman
    • SequenceMVSRKAVAALLVVHAAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKS LSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPAT LEGLLSEMLPQHAAK
    • Molecular weight39 kDa including tags
    • Amino acids1 to 115

Specifications

Our Abpromise guarantee covers the use of ab116979 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MAP
    • MGC138519
    • MLN
    • MOTI_HUMAN
    • Motilin-associated peptide
    • Promotilin
    see all
  • FunctionPlays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
  • Sequence similaritiesBelongs to the motilin family.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human Motilin protein images

  • 12.5% SDS-PAGE showing ab116979 at approximately 38.72kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Motilin protein (ab116979)

ab116979 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116979.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"