Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPVAATNSETAMQQVLDNLGSLPSATGAAELDLIFLRGIMESPIVRSLAK AHERLEETKLEAVRDNNLELVQEILRDLAQLAEQSSTAAELAHILQEPHF QSLLETHDSVASKTYETPPPSPGLDPTFSNQPVPPDAVRMVGIRKTAGEH LGVTFRVEGGELVIARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRAL QELLRNASGSVILKILPSYQEPHLPRQVFVKCHFDYDPARDSLIPCKEAG LRFNAGDLLQIVNQDDANWWQACHVEGGSAGLIPSQLLEEKRKAFVKRDL ELTPNSGTLCGSLSGKKKKRMMYLTTKNAEFDRHELLIYEEVARMPPFRR KTLVLIGAQGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYS FVSRGEMEADVRAGRYLEHGEYEGNLYGTRIDSIRGVVAAGKVCVLDVNP QAVKVLRTAEFVPYVVFIEAPDFETLRAMNRAALESGISTKQLTEADLRR TVEESSRIQRGYGHYFDLCLVNSNLERTFRELQTAMEKLRTEPQWVPVSW VY
    • Amino acids
      1 to 552
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158916 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D11BWG0652E
    • Discs Large Homolog 2
    • DLG2
    • DLGH2
    • Homolog of DLG A tumor supressor
    • MAGUK p55 Subfamily Member 2
    • Membrane Protein Palmitoylated 2
    • MPP2_HUMAN
    • PALS4
    see all
  • Relevance
    MPP2 (Palmitoylated membrane protein 2) is a member of a family of membrane associated proteins termed MAGUKs (membrane associated guanylate kinase homologs). These proteins interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions. MPP2 contains a conserved sequence, called the SH3 (src homology 3) motif, found in several other proteins that associate with the cytoskeleton and are suspected to play important roles in signal transduction.
  • Cellular localization
    Cell Membrane; integral membrane protein

Images

  • ab158916 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158916 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158916.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up