Overview

  • Product name
    Recombinant Human MPP4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIQSDKGADPPDKKDMKLSTATNPQNGLSQILRLVLQELSLFYSRDVNGV CLLYDLLHSPWLQALLKIYDCLQEFKEKKLVPATPHAQVLSYEVVELLRE TPTSPEIQE
    • Amino acids
      1 to 109
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163698 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALS2CR5
    • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 5 protein
    • Discs large homolog 6
    • Discs large, Drosophila, homolog of, 6
    • DLG6
    • MAGUK p55 subfamily member 4
    • Membrane palmitoylated protein 4
    • Membrane protein, palmitoylated 4 (MAGUK p55 subfamily member 4)
    • MPP4
    • MPP4_HUMAN
    • OTTHUMP00000205933
    • OTTHUMP00000209441
    • OTTHUMP00000209442
    • OTTHUMP00000209443
    see all
  • Function
    May play a role in retinal photoreceptors development.
  • Tissue specificity
    Expressed in the retina (at protein level). Highly expressed in the retina. Lower amounts are detected in brain, testis, ARPE-19, RPE/choroid and fetal eye. Isoform 5 is retina-specific.
  • Sequence similarities
    Belongs to the MAGUK family.
    Contains 1 guanylate kinase-like domain.
    Contains 2 L27 domains.
    Contains 1 PDZ (DHR) domain.
    Contains 1 SH3 domain.
  • Cellular localization
    Cytoplasm. Detected at the outer limiting membrane (OLM) and in the outer plexiform layer (OPL) of the retina. At the OLM, detected apical to the adherens junction.
  • Information by UniProt

Images

  • ab163698 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163698 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163698.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up