Overview

  • Product name
    Recombinant Human MPP7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSL VKIHEKLHYYEKQSPVPILHGAAALADDLAEELQNKPLNSEIRELLKLLS KPNVKALLSVHDTVAQKNYDPVLPPMPEDIDDEEDSVKIIRLVKNREPLG ATIKKDEQTGAIIVARIMRGGAADRSGLIHVGDELREVNGIPVEDKRPEE IIQILAQSQGAITFKIIPGSKEETPSKEGKMFIKALFDYNPNEDKAIPCK EAGLSFKKGDILQIMSQDDATWWQAKHEADANPRAGLIPSKHFQERRLAL RRPEILVQPLKVSNRKSSGFRRSFRLSRKDKKTNKSMYECKKSDQYDTAD VPTYEEVTPYRRQTNEKYRLVVLVGPVGVGLNELKRKLLISDTQHYGVTV PHTTRARRSQESDGVEYIFISKHLFETDVQNNKFIEYGEYKNNYYGTSID SVRSVLAKNKVCLLDVQPHTVKHLRTLEFKPYVIFIKPPSIERLRETRKN AKIISSRDDQGAAKPFTEEDFQEMIKSAQIMESQYGHLFDKIIINDDLTV AFNELKTTFDKLETETHWVPVSWLHS
    • Amino acids
      1 to 576
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165495 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ32798
    • MAGUK p55 subfamily member 7
    • Membrane protein palmitoylated 7 MAGUK p55 subfamily member 7
    • MPP7
    • MPP7_HUMAN
    • Palmitoylated membrane protein 7
    see all
  • Function
    Acts as an important adapter that promotes epithelial cell polarity and tight junction formation via its interaction with DLG1. Involved in the assembly of protein complexes at sites of cell-cell contact.
  • Sequence similarities
    Belongs to the MAGUK family.
    Contains 1 guanylate kinase-like domain.
    Contains 2 L27 domains.
    Contains 1 PDZ (DHR) domain.
    Contains 1 SH3 domain.
  • Cellular localization
    Membrane. Cell junction > tight junction. Cell junction > adherens junction.
  • Information by UniProt

Images

  • ab165495 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165495 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165495.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up