Overview

  • Product name
    Recombinant Human MPPE1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LLFCEFLIYYLAIFQCNWPEVKTTASDGEQTTREPVLKAMFLADTHLLGE FLGHWLDKLRREWQMERAFQTALWLLQPEVVFILGDIFDEGKWSTPEAWA DDVERFQKMFRHPSHVQLKVVAGNHDIGFHYEMNTYKVERFEKVFSSERL FSWKGINFVMVNSVALNGDGCGICSETEAELIEVSHRLNCSRELLWWLQP RLVLSGHTHSACEVHHGGRVPELSVPSFSWRNRNNPSFIMGSITPTDYTL SKCYLPREDVVLIIYCGVVGFLVVLTLTHFGLLASPFLSGLNLLGKRKTR
    • Amino acids
      34 to 333
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163927 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 3.1.-.-
    • Metallo phosphoesterase
    • Metallophosphoesterase 1
    • PGAP5
    • Post-GPI attachment to proteins factor 5
    see all
  • Relevance
    The specific function of metallophosphoesterase 1 (MPPE1) is not yet known. There are 5 isoforms produced by alternative splicing which have molecular weights of 45 kDa, 39 kDa (2 isoforms), 38 kDa and 29 kDa.
  • Cellular localization
    Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Note: Also localizes to endoplasmic reticulum exit site.

Images

  • ab163927 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163927 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163927.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up