Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSG TVNQIMMMANNPEDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPP DKYGQNESFARIQVRFAELKAIQEPDDARDYFQMARANCKKFAFVHISFA QFELSQGNVKKSKQLLQKAVERGAVP
    • Amino acids
      1 to 176
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • cancer/testis antigen 96
    • CT96
    • Dual specificity protein kinase TTK
    • ECSTY kinase
    • ESK
    • FLJ38280
    • hMPS1
    • Monopolar Spindle 1 Like 1
    • MPH1
    • Mps 1
    • MPS1L1
    • Phosphotyrosine Picked Threonine Kinase
    • Phosphotyrosine picked threonine-protein kinase
    • PYT
    • RP3-357D13.2
    • ttk
    • TTK Protein Kinase
    • TTK_HUMAN
    see all
  • Function
    Phosphorylates proteins on serine, threonine, and tyrosine. Probably associated with cell proliferation. Essential for chromosome alignment by enhancing AURKB activity (via direct CDCA8 phosphorylation) at the centromere, and for the mitotic checkpoint.
  • Tissue specificity
    Present in rapidly proliferating cell lines.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab159755 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159755 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up