Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFE ERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIY DASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPA PAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGI EPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGS GVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH
    • Molecular weight
      59 kDa including tags
    • Amino acids
      1 to 297

Specifications

Our Abpromise guarantee covers the use of ab114832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 mercaptopyruvate sulfurtransferase
    • 3-mercaptopyruvate sulfurtransferase
    • Human liver rhodanese
    • Mercaptopyruvate sulfurtransferase
    • MGC24539
    • MPST
    • MST
    • THTM_HUMAN
    • TST2
    see all
  • Function
    Transfer of a sulfur ion to cyanide or to other thiol compounds. Also has weak rhodanese activity. May have a role in cyanide degradation or in thiosulfate biosynthesis.
  • Sequence similarities
    Contains 2 rhodanese domains.
  • Domain
    The structure consists of 2 domains of very similar conformation, suggesting a common evolutionary origin. However, the sequences of the 2 domains are very different.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab114832 analyzed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114832 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up