Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP25325
    • SpeciesHuman
    • SequenceMASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFE ERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIY DASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPA PAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGI EPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGS GVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH
    • Molecular weight59 kDa including tags
    • Amino acids1 to 297

Specifications

Our Abpromise guarantee covers the use of ab114832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 mercaptopyruvate sulfurtransferase
    • 3-mercaptopyruvate sulfurtransferase
    • Human liver rhodanese
    • Mercaptopyruvate sulfurtransferase
    • MGC24539
    • MPST
    • MST
    • THTM_HUMAN
    • TST2
    see all
  • FunctionTransfer of a sulfur ion to cyanide or to other thiol compounds. Also has weak rhodanese activity. May have a role in cyanide degradation or in thiosulfate biosynthesis.
  • Sequence similaritiesContains 2 rhodanese domains.
  • DomainThe structure consists of 2 domains of very similar conformation, suggesting a common evolutionary origin. However, the sequences of the 2 domains are very different.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human MPST protein images

  • ab114832 analyzed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human MPST protein (ab114832)

ab114832 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"