Recombinant Human MR1 protein (ab158661)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: WB, ELISA
Description
-
Product name
Recombinant Human MR1 protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
TEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYG DILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPL -
Amino acids
201 to 300 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab158661 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Class I histocompatibility antigen like protein
- Class I histocompatibility antigen-like protein
- HLALS
see all -
Function
Antigen-presenting molecule specialized in presenting microbial vitamin B metabolites. Involved in the development and expansion of a small population of T-cells expressing an invariant T-cell receptor alpha chain called mucosal-associated invariant T-cells (MAIT). MAIT lymphocytes are preferentially located in the gut lamina propria and therefore may be involved in monitoring commensal flora or serve as a distress signal. Expression and MAIT cell recognition seem to be ligand-dependent. -
Tissue specificity
Ubiquitous. -
Sequence similarities
Belongs to the MHC class I family.
Contains 1 Ig-like C1-type (immunoglobulin-like) domain. -
Domain
The alpha-3 region and to a lesser extent the transmembrane and cytosolic domains regulate surface expression. The alpha-3 region mediates interaction with B2M (PubMed:23051753).
The ligand-binding groove is ideally suited to present small organic compounds that can originate from vitamins rather than antigenic peptides. -
Post-translational
modificationsN-glycosylated. -
Cellular localization
Secreted; Cell membrane. Endoplasmic reticulum and Cell membrane. Endoplasmic reticulum membrane. The larger proportion remains in the ER in an immature state. The subset that reach cell surface does it through a B2M-independent pathway. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab158661 has not yet been referenced specifically in any publications.