Overview

  • Product name
    Recombinant Human MR1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYG DILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPL
    • Amino acids
      201 to 300
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158661 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Class I histocompatibility antigen like protein
    • Class I histocompatibility antigen-like protein
    • HLALS
    • HMR1_HUMAN
    • Major histocompatibility complex class I like sequence
    • Major histocompatibility complex class I related
    • Major histocompatibility complex class I related gene protein
    • Major histocompatibility complex class I related isoform CRA a
    • Major histocompatibility complex class I related isoform CRA c
    • Major histocompatibility complex class I related isoform CRA d
    • Major histocompatibility complex class I-related gene protein
    • MHC class I like antigen MR 1
    • MHC class I like antigen MR1
    • MHC class I related gene protein
    • MHC class I related protein 1 isoform B
    • MHC class I related protein 1 isoform C
    • MHC class I-related gene protein
    • MR 1
    • Mr1
    • Mr1 protein
    • MR1B
    • MR1C
    see all
  • Function
    Antigen-presenting molecule specialized in presenting microbial vitamin B metabolites. Involved in the development and expansion of a small population of T-cells expressing an invariant T-cell receptor alpha chain called mucosal-associated invariant T-cells (MAIT). MAIT lymphocytes are preferentially located in the gut lamina propria and therefore may be involved in monitoring commensal flora or serve as a distress signal. Expression and MAIT cell recognition seem to be ligand-dependent.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the MHC class I family.
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
  • Domain
    The alpha-3 region and to a lesser extent the transmembrane and cytosolic domains regulate surface expression. The alpha-3 region mediates interaction with B2M (PubMed:23051753).
    The ligand-binding groove is ideally suited to present small organic compounds that can originate from vitamins rather than antigenic peptides.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Secreted; Cell membrane. Endoplasmic reticulum and Cell membrane. Endoplasmic reticulum membrane. The larger proportion remains in the ER in an immature state. The subset that reach cell surface does it through a B2M-independent pathway.
  • Information by UniProt

Images

  • ab158661 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158661 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158661.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up