Overview

  • Product name
    Recombinant Human MRC2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ASLGMYECDREALNLRWHCRTLGDQLSLLLGARTSNISKPGTLERGDQTR SGQWRIYGSEEDLCALPYHEVYTIQGNSHGKPCTIPFKYDNQWFHGCTST GREDGHLWCA
    • Molecular weight
      38 kDa including tags
    • Amino acids
      105 to 214

Specifications

Our Abpromise guarantee covers the use of ab112386 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

    Other

  • Form
    Liquid
  • Additional notes
    Best to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • C-type lectin domain family 13 member E
    • C-type mannose receptor 2
    • CD 280
    • CD280
    • CD280 antigen
    • CLEC 13E
    • CLEC13E
    • ENDO 180
    • ENDO180
    • Endocytic receptor (macrophage mannose receptor family)
    • Endocytic receptor 180
    • FLJ35911
    • KIAA0709
    • Macrophage mannose receptor 2
    • Mannose receptor C type 2
    • MRC 2
    • MRC2
    • MRC2_HUMAN
    • UPAR-associated protein
    • UPARAP
    • Urokinase plasminogen activator receptor associated protein
    • Urokinase receptor associated protein
    • Urokinase receptor-associated protein
    • Urokinase-type plasminogen activator receptor-associated protein
    see all
  • Function
    May play a role as endocytotic lectin receptor displaying calcium-dependent lectin activity. Internalizes glycosylated ligands from the extracellular space for release in an endosomal compartment via clathrin-mediated endocytosis. May be involved in plasminogen activation system controlling the extracellular level of PLAUR/PLAU, and thus may regulate protease activity at the cell surface. May contribute to cellular uptake, remodeling and degradation of extracellular collagen matrices. May play a role during cancer progression as well as in other chronic tissue destructive diseases acting on collagen turnover. May participate in remodeling of extracellular matrix co-operating with the matrix metalloproteinases (MMPs).
  • Tissue specificity
    Ubiquitous with low expression in brain, placenta, lung, kidney, pancreas, spleen, thymus and colon. Expressed in endothelial cells, fibroblasts and macrophages. Highly expressed in fetal lung and kidney.
  • Sequence similarities
    Contains 8 C-type lectin domains.
    Contains 1 fibronectin type-II domain.
    Contains 1 ricin B-type lectin domain.
  • Domain
    C-type lectin domains 3 to 8 are not required for calcium-dependent binding of mannose, fucose and N-acetylglucosamine. C-type lectin domain 2 is responsible for sugar-binding in a calcium-dependent manner.
    Fibronectin type-II domain mediates collagen-binding.
    Ricin B-type lectin domain contacts with the second C-type lectin domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab112386. Stained with Coomassie Blue

References

ab112386 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112386.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up