Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP19105
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMSSKRTKTKTKKRPQRATSNVFAMFD QSQIQEFKEAFNMIDQNR DGFIDKEDLHDMLASLGKNPTDEYLDAMMN EAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE DYL RELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
    • Molecular weight22 kDa including tags
    • Amino acids1 to 171
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113139 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab113139 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • ML12A_HUMAN
    • MLC 2B
    • MLC-2B
    • MLCB
    • MYL12A
    • Myosin regulatory light chain 12A
    • Myosin regulatory light chain 2
    • Myosin regulatory light chain 2, nonsarcomeric
    • Myosin regulatory light chain MRCL3
    • Myosin regulatory light chain MRLC3
    • Myosin RLC
    • Myosin, light polypeptide, regulatory, non sarcomeric (20kD)
    • nonsarcomeric
    • RLC
    see all
  • FunctionMyosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion.
  • Sequence similaritiesContains 3 EF-hand domains.
  • Post-translational
    modifications
    Phosphorylation increases the actin-activated myosin ATPase activity and thereby regulates the contractile activity. It is required to generate the driving force in the migration of the cells but not necessary for localization of myosin-2 at the leading edge.
  • Information by UniProt

Recombinant Human MRCL3 protein images

  • 15% SDS-PAGE analysis of ab113139 (3µg)

References for Recombinant Human MRCL3 protein (ab113139)

ab113139 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113139.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"