Overview

  • Product name
    Recombinant Human Mre11 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSTADALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQEN EVDFILLGGDLFHENKPSRKTLHTCLELLRKYCMGDRPVQFEILSDQSVN FGFSKFPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCALDILSCAGFV NHFGRSMSVEKIDISPVLLQKGRTKIALYGLGSIPDERLYRMFVNKKVTM LRPKED
    • Molecular weight
      49 kDa including tags
    • Amino acids
      1 to 206

Specifications

Our Abpromise guarantee covers the use of ab114277 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • AT like disease
    • Ataxia telangiectasia disorder like
    • ATLD
    • DNA recombination and repair protein
    • Double strand break repair protein MRE11A
    • Double-strand break repair protein MRE11A
    • endo/exonuclease Mre11
    • HNGS1
    • meiotic recombination (S. cerevisiae) 11 homolog A
    • Meiotic recombination 11 homolog 1
    • Meiotic recombination 11 homolog A
    • meiotic recombination 11 homolog A (S. cerevisiae)
    • MmMRE11A
    • Mre 11
    • MRE 11a
    • MRE 11b
    • MRE11 homolog 1
    • MRE11 homolog A
    • MRE11 homolog double strand break repair nuclease
    • MRE11 meiotic recombination 11 homolog A
    • MRE11 meiotic recombination 11 homolog A (S. cerevisiae)
    • MRE11_HUMAN
    • MRE11A
    • MRE11b
    • OTTHUMP00000236830
    • OTTHUMP00000236831
    • OTTHUMP00000236832
    • OTTHUMP00000236833
    see all
  • Function
    Component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis. The complex possesses single-strand endonuclease activity and double-strand-specific 3'-5' exonuclease activity, which are provided by MRE11A. RAD50 may be required to bind DNA ends and hold them in close proximity. This could facilitate searches for short or long regions of sequence homology in the recombining DNA templates, and may also stimulate the activity of DNA ligases and/or restrict the nuclease activity of MRE11A to prevent nucleolytic degradation past a given point. The complex may also be required for DNA damage signaling via activation of the ATM kinase. In telomeres the MRN complex may modulate t-loop formation.
  • Involvement in disease
    Defects in MRE11A are a cause of ataxia telangiectasia-like disorder (ATLD) [MIM:604391]. ATLD is a disease with the same clinical feature than ataxia-telangiectasia but with a somewhat milder clinical course.
  • Sequence similarities
    Belongs to the MRE11/RAD32 family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus. Localizes to discrete nuclear foci after treatment with genotoxic agents.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of Mre11 protein (ab114277). Stained with Coomassie Blue.

References

ab114277 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114277.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up