Recombinant Human MRGPRF protein (ab165933)

Overview

  • Product name
    Recombinant Human MRGPRF protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYI FLLLCLCGLVGNGLVLWFFGFSIKRNPFSIYFLHLASADVGYLFSKAVFS ILNTGGFLGTFADYIRSVCRVLGLCMFLTGVSLLPAVSAERCASVIFPAW YWRRRPKRLSAVVCALLWVLSLLVTCLHNYFCVFLGRGAPGAACRHMDIF LGILLFLLCCPLMVLPCLALILHVECRARRRQRSAKLNHVILAMVSVFLV SSIYLGIDWFLFWVFQIPAPFPEYVTDLCICINSSAKPIVYFLAGRDKSQ RLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS
    • Amino acids
      1 to 343
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp586B2122
    • FLJ16111
    • FLJ29034
    • FLJ40998
    • FLJ53714
    • G protein coupled receptor 140
    • G protein coupled receptor 168
    • G protein coupled receptor MrgF
    • G-protein coupled receptor 140
    • G-protein coupled receptor 168
    • GPR140
    • GPR168
    • Mas related G protein coupled MRGF
    • Mas related G protein coupled receptor member F
    • Mas related gene F protein
    • MAS related GPR member F
    • Mas-related G-protein coupled receptor member F
    • Mas-related gene F protein
    • MGC21621
    • MRGF
    • Mrgprf
    • MRGRF_HUMAN
    • RTA
    • Seven transmembrane helix receptor
    see all
  • Information by UniProt

Images

  • ab165933 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up