Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDQRQRRILGQPLSIPTSQPKQKRTSMISFFSKVSWKLRFQKREPLKNVF FILAERARDPSAKKRHMAMRNLGTMAYEAPDKVRKYKKIVLDLLVYGLYD PVNLEVIHESMKTLTVVLGKIQGKGLGSFFIDIALQTRTLLDDENDSLRY SAFVLFGQLAAFAGRKWKKFFTSQVKQTRDSLLIHLQDRNPQVAKACKTT FQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFFYANKIL
    • Amino acids
      1 to 248
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164453 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B29
    • beside the Ma29 deletion
    • C18orf3
    • Male-specific transcription in the developing reproductive organs
    • Mro
    • MSTRO_HUMAN
    • Protein B29
    • Protein maestro
    see all
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 HEAT repeat.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab164453 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:
  • Kenigsberg S  et al. The elusive MAESTRO gene: Its human reproductive tissue-specific expression pattern. PLoS One 12:e0174873 (2017). WB . Read more (PubMed: 28406912) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164453.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up