Overview

  • Product name
    Recombinant Human MRP2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEK SSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKA
    • Molecular weight
      37 kDa including tags
    • Amino acids
      214 to 313
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112272 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • ABC30
    • abcC2
    • ATP binding cassette sub family C (CFTR/MRP) member 2
    • ATP binding cassette subfamily C member 2
    • ATP-binding cassette sub-family C member 2
    • Canalicular multidrug resistance protein
    • Canalicular multispecific organic anion transporter 1
    • CMOAT
    • CMOAT1
    • cMRP
    • DJS
    • KIAA1010
    • MRP 2
    • MRP2_HUMAN
    • Multidrug resistance associated protein 2
    • Multidrug resistance-associated protein 2
    see all
  • Function
    Mediates hepatobiliary excretion of numerous organic anions. May function as a cellular cisplatin transporter.
  • Tissue specificity
    Found on the apical membrane of polarized cells in liver, kidney and intestine. The highest expression is found in liver.
  • Involvement in disease
    Defects in ABCC2 are the cause of Dubin-Johnson syndrome (DJS) [MIM:237500]. DJS is an autosomal recessive disorder characterized by conjugated hyperbilirubinemia, an increase in the urinary excretion of coproporphyrin isomer I, deposition of melanin-like pigment in hepatocytes, and prolonged retention of sulfobromophthalein, but otherwise normal liver function.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human MRP2 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human MRP2 protein (ab112272)

ab112272 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112272.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up