Overview

  • Product name
    Recombinant Human MRP2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEK SSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKA
    • Molecular weight
      37 kDa including tags
    • Amino acids
      214 to 313
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112272 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • ABC30
    • abcC2
    • ATP binding cassette sub family C (CFTR/MRP) member 2
    • ATP binding cassette subfamily C member 2
    • ATP-binding cassette sub-family C member 2
    • Canalicular multidrug resistance protein
    • Canalicular multispecific organic anion transporter 1
    • CMOAT
    • CMOAT1
    • cMRP
    • DJS
    • KIAA1010
    • MRP 2
    • MRP2_HUMAN
    • Multidrug resistance associated protein 2
    • Multidrug resistance-associated protein 2
    see all
  • Function
    Mediates hepatobiliary excretion of numerous organic anions. May function as a cellular cisplatin transporter.
  • Tissue specificity
    Found on the apical membrane of polarized cells in liver, kidney and intestine. The highest expression is found in liver.
  • Involvement in disease
    Defects in ABCC2 are the cause of Dubin-Johnson syndrome (DJS) [MIM:237500]. DJS is an autosomal recessive disorder characterized by conjugated hyperbilirubinemia, an increase in the urinary excretion of coproporphyrin isomer I, deposition of melanin-like pigment in hepatocytes, and prolonged retention of sulfobromophthalein, but otherwise normal liver function.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References

ab112272 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112272.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up