Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CITERGTHEELMNLNGDYATIFNNLLLGETPPVEINSKKETSGSQKKSQD KGPKTGSVKKEKAVKPEEGQLVQLEEKGQGSVPWSVY
    • Amino acids
      760 to 846
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160791 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABC 33
    • ABC33
    • ABCC 5
    • Abcc5
    • ATP binding cassette sub family C (CFTR/MRP) member 5
    • ATP binding cassette sub family C member 5
    • ATP-binding cassette sub-family C member 5
    • Canalicular multispecific organic anion transporter C
    • DKFZp686C1782
    • EST277145
    • MOAT C
    • MOAT-C
    • MOATC
    • MRP 5
    • MRP5_HUMAN
    • Multi specific organic anion tranporter C
    • Multi-specific organic anion transporter C
    • Multidrug resistance associated protein 5
    • Multidrug resistance-associated protein 5
    • pABC 11
    • pABC11
    • SMRP
    see all
  • Function
    Acts as a multispecific organic anion pump which can transport nucleotide analogs.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160791 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160791 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160791.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up