Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO95255
    • SpeciesHuman
    • SequenceIAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAG RRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRV
    • Molecular weight37 kDa including tags
    • Amino acids831 to 930

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114729 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABC34
    • Abcc6
    • Anthracycline resistance-associated protein
    • ARA
    • ATP binding cassette sub family C (CFTR/MRP) member 6
    • ATP binding cassette sub family C member 6
    • ATP-binding cassette sub-family C member 6
    • EST349056
    • MLP1
    • MOAT E
    • MOAT-E
    • MOATE
    • MRP 6
    • MRP6
    • MRP6_HUMAN
    • Multi-specific organic anion transporter E
    • Multidrug resistance associated protein 6
    • Multidrug resistance-associated protein 6
    • multispecific organic anion transporter E
    • PXE
    • PXE1
    • URG7
    • URG7 protein
    see all
  • FunctionMay participate directly in the active transport of drugs into subcellular organelles or influence drug distribution indirectly. Transports glutathione conjugates as leukotriene-c4 (LTC4) and N-ethylmaleimide S-glutathione (NEM-GS).
  • Tissue specificityExpressed in kidney and liver. Very low expression in other tissues.
  • Involvement in diseaseDefects in ABCC6 are the cause of pseudoxanthoma elasticum (PXE) [MIM:264800]. PXE is a disorder characterized by calcification of elastic fibers in skin, arteries and retina that results in dermal lesions with associated laxity and loss of elasticity, arterial insufficiency and retinal hemorrhages leading to macular degeneration. PXE is caused in the overwhelming majority of cases by homozygous or compound heterozygous mutations in the ABCC6 gene (autosomal recessive PXE). Individuals carrying heterozygous mutations express limited manifestations of the pseudoxanthoma elasticum phenotype (autosomal dominant PXE).
  • Sequence similaritiesBelongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localizationMembrane. Localized to the basolateral membrane.
  • Information by UniProt

Recombinant Human MRP6 protein images

  • 12.5% SDS-PAGE showing ab114729 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human MRP6 protein (ab114729)

ab114729 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114729.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"