Recombinant Human MRPL48 protein (ab162620)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSGTLGKVLCLRNNTIFKQAFSLLRFRTSGEKPIYSVGGILLSISRPYKT KPTHGIGKYKHLIKAEEPKKKKGKVEVRAINLGTDYEYGVLNIHLTAYDM TLAESYAQYVHNLCNSLSIKVEESYAMPTKTIEVLQLQDQGSKMLLDSVL TTHERVVQISGLSATFAEIFLEIIQSSLPEGVRLSVKEHTEEDFKGRFKA RPELEELLAKLK
    • Amino acids
      1 to 212
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162620 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 39S ribosomal protein L48
    • 39S ribosomal protein L48 mitochondrial
    • CGI 118
    • CGI-118
    • FLJ17047
    • FLJ99260
    • HSPC290
    • L48mt
    • MGC13323
    • mitochondrial
    • Mitochondrial ribosomal protein L48
    • MRP L48
    • MRP-L48
    • MRPL48
    • RM48_HUMAN
    see all
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab162620 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162620 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162620.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up