Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMATSSAALPRILGAGARAPSRWLGFLG KATPRPARPSRRTLGSATALMIRESEDSTDFNDKILNEPLKHSDFFNVKE LFSVRSLFDARVHLGHKAGCRHRFMEPYIFGSRLDHDIIDLEQTATHLQL ALNFTAHMAYRKGIILFISRNRQFSYLIENMARDCGEYAHTRYFRGGMLT NARLLFGPTVRLPDLIIFLHTLNNIFEPHVAVRDAAKMNIPTVGIVDTNC NPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQK EPGDQGPAHPPGADMSHSL
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 296
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • 28S ribosomal protein S2
    • 28S ribosomal protein S2 mitochondrial
    • CGI 91
    • CGI91
    • mitochondrial
    • Mitochondrial 28S ribosomal protein S2
    • Mitochondrial ribosomal protein S2
    • MRP S2
    • MRP-S2
    • MRPS2
    • OTTHUMP00000022545
    • OTTHUMP00000022546
    • RT02_HUMAN
    • S2mt
    see all
  • Sequence similarities
    Belongs to the ribosomal protein S2P family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab171597.

References

ab171597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up