Recombinant Human MRPS23 protein (denatured) (ab187425)

Overview

  • Product name
    Recombinant Human MRPS23 protein (denatured)
  • Protein length
    Full length protein
  • Description
    Recombinant Human MRPS23 protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAGSRLETVGSIFSRTRDLVRAGVLKE KPLWFDVYDAFPPLREPVFQRPRVRYGKAKAPIQDIWYHEDRIRAKFYSV YGSGQRAFDLFNPNFKSTCQRFVEKYTELQKLGETDEEKLFVETGKALLA EGVILRRVGEARTQHGGSHVSRKSEHLSVRPQTALEENETQKEVPQDQHL EAPADQSKGLLPP
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 190
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NCBI Accession No. NP_057154

Specifications

Our Abpromise guarantee covers the use of ab187425 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.
    ab187425 is purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20 mM Tris pH 7.5, 2 mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names
    • 28S ribosomal protein S23
    • 28S ribosomal protein S23, mitochondrial
    • CGI 138
    • CGI-138
    • HSPC329
    • mitochondrial
    • Mitochondrial ribosomal protein S23
    • MRP S23
    • MRP-S23
    • MRPS23
    • RT23_HUMAN
    • S23mt
    see all
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab187425 (3μg).

References

ab187425 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187425.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up