Recombinant Human MRPS35 protein (ab163724)

Overview

  • Product name
    Recombinant Human MRPS35 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRR KALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKE GNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIE IDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCK TTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEE YIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLK NEEENENSISQYKESVKRLLNVT
    • Amino acids
      1 to 323
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163724 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 28S ribosomal protein S28
    • 28S ribosomal protein S28, mitochondrial
    • 28S ribosomal protein S35
    • 28S ribosomal protein S35 mitochondrial precursor
    • 28S ribosomal protein S35, mitochondrial
    • DKFZp762P093
    • HDCMD11P
    • MDS023
    • MGC104278
    • mitochondrial
    • Mitochondrial ribosomal protein S28
    • Mitochondrial ribosomal protein S35
    • MRP S28
    • MRP S35
    • MRP-S28
    • MRP-S35
    • MRPS 28
    • MRPS 35
    • MRPS28
    • MRPS35
    • OTTHUMP00000240420
    • OTTHUMP00000240422
    • OTTHUMP00000240424
    • PSEC0213
    • RT35_HUMAN
    • S28mt
    • S35mt
    see all
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab163724 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163724 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163724.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up