Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTW LTVLKKEQE
    • Amino acids
      1 to 59
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158423 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • APY
    • ATOPY
    • Fc epsilon receptor I beta-chain
    • Fc IgE receptor beta chain
    • FCER1B
    • FCERB_HUMAN
    • FcERI
    • High affinity immunoglobulin epsilon receptor subunit beta
    • IgE Fc receptor subunit beta
    • IGEL
    • IGHER
    • Membrane-spanning 4-domains subfamily A member 2
    • MS4A1
    • Ms4a2
    see all
  • Function
    High affinity receptor that binds to the Fc region of immunoglobulins epsilon. Aggregation of FCER1 by multivalent antigens is required for the full mast cell response, including the release of preformed mediators (such as histamine) by degranulation and de novo production of lipid mediators and cytokines. Also mediates the secretion of important lymphokines. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators responsible for the manifestations of allergy.
  • Tissue specificity
    Found on the surface of mast cells and basophils.
  • Sequence similarities
    Belongs to the MS4A family.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues by LYN.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158423 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158423 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158423.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up