Overview

  • Product name
    Recombinant Human MS4A7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGT VQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGS LSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCG SEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAA YSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI
    • Amino acids
      1 to 240
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163672 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4SPAN2
    • CD20 antigen like 4
    • CD20/Fc epsilon RI beta family member 4
    • CD20L4
    • CFFM4
    • Four span transmembrane protein 2
    • High affinity immunoglobulin epsilon receptor beta subunit
    • Membrane spanning 4 domains subfamily A member 7
    • MGC22368
    • MS4A8
    see all
  • Relevance
    MS4A7 (Membrane-spanning 4-domains, subfamily A, member 7) is a member of the membrane-spanning 4A gene family which share structural similarity, amino acid sequence homology, and chromosomal location. It is associated with mature cellular function in the monocytic lineage, and it may be involved in signal transduction as a component of a multimeric receptor complex.
  • Cellular localization
    Membrane; Multi-pass membrane protein.

Images

  • ab163672 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163672 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163672.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up