Recombinant Human mSin3A protein (ab153256)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQS ATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVV
    • Amino acids
      1 to 99
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153256 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AW553200
    • DKFZP434K2235
    • FLJ90319
    • Histone deacetylase complex subunit Sin 3a
    • Histone deacetylase complex subunit Sin3a
    • KIAA0700
    • Kiaa4126
    • mKIAA4126
    • Paired amphipathic helix protein Sin 3a
    • Paired amphipathic helix protein Sin3a
    • Sin 3a
    • SIN3 homolog A
    • SIN3 homolog A transcription regulator
    • SIN3 homolog A transcription regulator (yeast)
    • SIN3 transcription regulator homolog A
    • Sin3a
    • SIN3A protein
    • SIN3A_HUMAN
    • Transcriptional co repressor Sin 3A
    • Transcriptional co repressor Sin3A
    • Transcriptional corepressor Sin3a
    • Transcriptional regulator SIN3A
    see all
  • Function
    Acts as a transcriptional repressor. Interacts with MXI1 to repress MYC responsive genes and antagonize MYC oncogenic activities. Also interacts with MAD-MAX heterodimers by binding to MAD. The heterodimer then represses transcription by tethering SIN3A to DNA. Acts as a corepressor for REST.
  • Sequence similarities
    Contains 3 PAH (paired amphipathic helix) domains.
  • Post-translational
    modifications
    SUMO1 sumoylated by TOPORS. Probably desumoylated by SENP2.
  • Cellular localization
    Nucleus. Nucleus > nucleolus. Recruited to the nucleolus by SAP30L.
  • Information by UniProt

Images

  • ab153256 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153256 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153256.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up