Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ILKSEPPYPQEMSALAKDLIQRLLMKDPKKRLGCGPRDADEIKEHLFFQK INWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYSPAALPQSSEK
    • Amino acids
      271 to 370
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152965 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 90 kDa ribosomal protein S6 kinase 5
    • EC 2.7.11.1
    • KS6A5_HUMAN
    • MGC1911
    • Mitogen and stress activated protein kinase 1
    • MSPK1
    • Nuclear Mitogen And Stress Activated Protein Kinase 1
    • Nuclear mitogen- and stress-activated protein kinase 1
    • Ribosomal protein S6 kinase 90kD polypeptide 5
    • Ribosomal protein S6 kinase 90kDa
    • Ribosomal protein S6 kinase 90kDa polypeptide 5
    • Ribosomal Protein S6 Kinase Alpha 5
    • Ribosomal protein S6 kinase alpha-5
    • RLPK
    • RPS6KA5
    • RSK Like Protein Kinase
    • RSK-like protein kinase
    • RSKL
    • S6K alpha 5
    • S6K-alpha-5
    see all
  • Function
    Serine/threonine kinase required for the mitogen or stress-induced phosphorylation of the transcription factors CREB (cAMP response element-binding protein) and ATF1 (activating transcription factor-1). Essential role in the control of RELA transcriptional activity in response to TNF. Directly represses transcription via phosphorylation of 'Ser-1' of histone H2A. Phosphorylates 'Ser-10' of histone H3 in response to mitogenics, stress stimuli and epidemal growth-factor (EGF), which results in the transcriptional activation of several immediate early genes, including proto-oncogenes c-fos/FOS and c-jun/JUN. May also phosphorylate 'Ser-28' of histone H3. Mediates the mitogen- and stress-induced phosphorylation of high mobility group protein 14 (HMG-14).
  • Tissue specificity
    Widely expressed with high levels in heart, brain and placenta. Less abundant in lung, kidney and liver.
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 2 protein kinase domains.
  • Post-translational
    modifications
    Ser-376 and Thr-581 phosphorylation is required for kinase activity. Ser-376 and Ser-212 are autophosphorylated by the C-terminal kinase domain, and their phosphorylation is essential for the catalytic activity of the N-terminal kinase domain.
  • Cellular localization
    Nucleus. Cytoplasm. Predominantly nuclear. Partially cytoplasmic.
  • Information by UniProt

Images

  • ab152965 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152965 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152965.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up