Recombinant Human MSL2L1 protein (ab162995)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHL LQDPIAPTNSTCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILV NCYKKLCEYITQTTLARDIIEAVDCSSDILALLNDGSLFCEETEKPSDSS FTLCLTHSPLPSTSEPTTDPQASLSPMSESTLSIAIGSSVINGLPTYNGL SIDRFGINIPSPEHSNTIDVCNTVDIKTEDLSDSLPPVCDTVATDLCSTG IDICSFSEDIKPGDSLLLSVEEVLRSLETVSNTEVCCPNLQPNLEATVSN GPFLQLSSQSLSHNVFMSTSPALHGLSCTAATPKIAKLNRKRSRSESDSE KVQPLPISTIIRGPTLGASAPVTVKRESKISLQPIATVPNGGTTPKISKT VLLSTKSMKKSHEHGSKKSHSKTKPGILKKDKAVKEKIPSHHFMPGSPTK TVYKKPQEKKGCKCGRATQNPSVLTCRGQRCPCYSNRKACLDCICRGCQN SYMANGEKKLEAFAVPEKALEQTRLTLGINVTSIAVRNASTSTSVINVTG SPVTTFLAASTHDDKSLDEAIDMRFDC
    • Amino acids
      1 to 577
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162995 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Male specific lethal 2 homolog
    • Male specific lethal 2 homolog (Drosophila)
    • Male specific lethal 2 homolog 1
    • Male specific lethal 2 like 1
    • Male-specific lethal 2 homolog
    • Male-specific lethal 2-like 1
    • Male-specific lethal-2 homolog 1
    • MSL-2
    • MSL2
    • MSL2-like 1
    • MSL2_HUMAN
    • MSL2L1
    • Ring finger protein 184
    see all
  • Function
    Component of histone acetyltransferase complex responsible for the majority of histone H4 acetylation at lysine 16 which is implicated in the formation of higher-order chromatin structure.
  • Sequence similarities
    Belongs to the MSL2 family.
    Contains 1 RING-type zinc finger.
  • Information by UniProt

Images

  • ab162995 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162995 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162995.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up