Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9Y3D2
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMVRGQAGGGGPGTGPGLGEAGSLATCELPL AKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFS SEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQC EAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH
    • Molecular weight20 kDa including tags
    • Amino acids21 to 182
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101946 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 7.5

General Info

  • Alternative names
    • CBS 1
    • CBS1
    • CGI 131
    • Methionine sulfoxide reductase B2
    • Methionine-R-sulfoxide reductase B2
    • MGC26104
    • mitochondrial
    • MSRB
    • MSRB 2
    • Msrb2
    • MSRB2_HUMAN
    • PILB
    • Pilin like transcription factor
    see all
  • Information by UniProt

Recombinant Human MSRB2 protein images

  • 15% SDS-PAGE analysis of 3µg ab101946.

References for Recombinant Human MSRB2 protein (ab101946)

ab101946 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"