Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMVRGQAGGGGPGTGPGLGEAGSLATCELPL AKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFS SEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQC EAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH
    • Molecular weight
      20 kDa including tags
    • Amino acids
      21 to 182
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101946 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 7.5

General Info

  • Alternative names
    • CBS 1
    • CBS1
    • CGI 131
    • Methionine sulfoxide reductase B2
    • Methionine-R-sulfoxide reductase B2
    • MGC26104
    • mitochondrial
    • MSRB
    • MSRB 2
    • Msrb2
    • MSRB2_HUMAN
    • PILB
    • Pilin like transcription factor
    see all
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab101946.

References

ab101946 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up