Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MCGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYT HHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSY GMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAE GGSGVASPAQADKAELLEHHHHHH
    • Molecular weight
      19 kDa including tags
    • Amino acids
      21 to 185
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104796 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab104796 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • Deafness, Autosomal Recessive 74
    • DFNB74
    • FLJ36866
    • Methionine R sulfoxide reductase B mitochondrial
    • Methionine sulfoxide reductase B3
    • Methionine-R-sulfoxide reductase B3
    • MsrB3
    • MSRB3_HUMAN
    see all
  • Function
    Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine. Isoform 2 is essential for hearing.
  • Tissue specificity
    Widely expressed.
  • Involvement in disease
    Deafness, autosomal recessive, 74
  • Sequence similarities
    Belongs to the MsrB Met sulfoxide reductase family.
    Contains 1 MsrB (methionine-R-sulfoxide reductase) domain.
  • Cellular localization
    Mitochondrion and Endoplasmic reticulum.
  • Information by UniProt

Recombinant Human MSRB3 protein images

  • 15% SDS-PAGE analysis of 3µg ab104796.

References for Recombinant Human MSRB3 protein (ab104796)

ab104796 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104796.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up