Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP26927
    • SpeciesHuman
    • SequenceQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMDCRA FHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKDYVRTCIMNNGVGY RG
    • Molecular weight37 kDa including tags
    • Amino acids19 to 120

Specifications

Our Abpromise guarantee covers the use of ab116865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D3F15S2
    • DNF15S2
    • Hepatocyte growth factor like protein
    • Hepatocyte growth factor like protein alpha chain
    • Hepatocyte growth factor like protein beta chain
    • Hepatocyte growth factor like protein homolog
    • Hepatocyte growth factor-like protein beta chain
    • HGFL
    • HGFL_HUMAN
    • Macrophage stimulating 1 (hepatocyte growth factor like)
    • Macrophage stimulatory protein
    • Macrophage-stimulating protein
    • MSP
    • MST1
    • NF15S2
    • OTTHUMP00000208927
    see all
  • FunctionProbably has no proteolytic activity, since crucial characteristic of serine proteases catalytic sites are not conserved.
  • Sequence similaritiesBelongs to the peptidase S1 family. Plasminogen subfamily.
    Contains 4 kringle domains.
    Contains 1 PAN domain.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications
    May be cleaved after Arg-483, to yield two chains held together by disulfide bonds, or two separate polypeptides.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human MST1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116865 at approximately 36.85 kDa.

References for Recombinant Human MST1 protein (ab116865)

ab116865 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"