Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVV AIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIME YLGGGSALDLLRALPPYERSLIQRKYRMGQSKILCKP
    • Amino acids
      1 to 137
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2610018G03Rik
    • EC 2.7.11.1
    • Mammalian Ste20 like protein kinase 4
    • Mammalian STE20-like protein kinase 4
    • Mammalian sterile 20 like 4
    • MASK
    • MST 4
    • MST-4
    • MST3 and SOK1 related kinase
    • Mst3 and SOK1-related kinase
    • Mst4
    • MST4_HUMAN
    • RGD1563568
    • RP23-245F8.1
    • RP6 213H19.1
    • Serine/threonine protein kinase 26
    • Serine/threonine protein kinase MASK
    • Serine/threonine protein kinase MST 4
    • Serine/threonine protein kinase MST4
    • Serine/threonine-protein kinase MASK
    • Serine/threonine-protein kinase MST4
    • STE20 like kinase MST 4
    • STE20 like kinase MST4
    • STE20-like kinase MST4
    • STK26
    see all
  • Function
    Mediator of cell growth. Modulates apoptosis.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization
    Cytoplasm. Golgi apparatus membrane. Localizes to the Golgi apparatus.
  • Information by UniProt

Images

  • ab162659 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162659 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up