Recombinant Human Msx2/Hox8 protein (ab114704)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP35548
    • SpeciesHuman
    • SequenceMASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVE ALMSDKKPPKEASPLPAESASAGATLRPLLLSGHGAREAHSPGPLVKPFE TASVKSENSEDGAAWMQEPGRYSPPPRHTSPTT
    • Molecular weight40 kDa including tags
    • Amino acids1 to 133

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114704 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CRS 2
    • CRS2
    • FPP
    • Homeo box msh like 2
    • Homeobox protein Hox-8
    • Homeobox protein MSX 2
    • Homeobox protein MSX-2
    • Homeobox protein MSX2
    • Hox 8
    • Hox8
    • MSH
    • Msh homeo box 2
    • Msh homeo box homolog
    • Msh homeo box homolog 2
    • Msh homeobox 2
    • Msh homeobox homolog 2
    • Msx 2
    • MSX2
    • MSX2_HUMAN
    • Parietal foramina 1
    • PFM
    • PFM 1
    • PFM1
    see all
  • FunctionActs as a transcriptional regulator in bone development. Represses the ALPL promoter activity and antogonizes the stimulatory effect of DLX5 on ALPL expression during osteoblast differentiation. Probable morphogenetic role. May play a role in limb-pattern formation. In osteoblasts, suppresses transcription driven by the osteocalcin FGF response element (OCFRE). Binds to the homeodomain-response element of the ALPL promoter.
  • Involvement in diseaseDefects in MSX2 are the cause of parietal foramina 1 (PFM1) [MIM:168500]; also known as foramina parietalia permagna (FPP). PFM1 is an autosomal dominant disease characterized by oval defects of the parietal bones caused by deficient ossification around the parietal notch, which is normally obliterated during the fifth fetal month.
    Defects in MSX2 are the cause of parietal foramina with cleidocranial dysplasia (PFMCCD) [MIM:168550]; also known as cleidocranial dysplasia with parietal foramina. PFMCCD combines skull defects in the form of enlarged parietal foramina and deficient ossification of the clavicles.
    Defects in MSX2 are the cause of craniosynostosis type 2 (CRS2) [MIM:604757]; also known as craniosynostosis Boston-type (CSB). CRS2 is an autosomal dominant disorder characterized by the premature fusion of calvarial sutures. The craniosynostosis phenotype is either fronto-orbital recession, or frontal bossing, or turribrachycephaly, or cloverleaf skull. Associated features include severe headache, high incidence of visual problems (myopia or hyperopia), and short first metatarsals. Intelligence is normal.
  • Sequence similaritiesBelongs to the Msh homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Msx2/Hox8 protein images

  • 12.5% SDS-PAGE showing ab114704 at approximately 40.26 kDa stained with Coomassie Blue.

References for Recombinant Human Msx2/Hox8 protein (ab114704)

ab114704 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114704.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"