Recombinant Human MT-ND1 protein (ab114460)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLTERKILGYIQLRKGPNVVGPYGLLQPFADAIKLFTKEPLKPATSTITL Y
    • Molecular weight
      31 kDa including tags
    • Amino acids
      21 to 71

Specifications

Our Abpromise guarantee covers the use of ab114460 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114460 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Complex I, subunit ND1
    • Mitochondrially encoded NADH dehydrogenase 1
    • MT-ND1
    • MTND1
    • NAD1
    • NADH dehydrogenase subunit 1
    • NADH dehydrogenase subunit 1 (complex I)
    • NADH-ubiquinone oxidoreductase chain 1
    • NADH-ubiquinone oxidoreductase, subunit ND1
    • NADH1
    • ND1
    • NU1M_HUMAN
    see all
  • Function
    Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Involvement in disease
    Defects in MT-ND1 are a cause of Leber hereditary optic neuropathy (LHON) [MIM:535000]. LHON is a maternally inherited disease resulting in acute or subacute loss of central vision, due to optic nerve dysfunction. Cardiac conduction defects and neurological defects have also been described in some patients. LHON results from primary mitochondrial DNA mutations affecting the respiratory chain complexes.
    Defects in MT-ND1 are a cause of mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes syndrome (MELAS) [MIM:540000]. MELAS is a genetically heterogenious disorder, characterized by episodic vomiting, seizures, and recurrent cerebral insults resembling strokes and causing hemiparesis, hemianopsia, or cortical blindness.
    Defects in MT-ND1 may be associated with susceptibility to Alzheimer disease mitochondrial (AD-MT) [MIM:502500]. Alzheimer disease is a neurodegenerative disorder characterized by progressive dementia, loss of cognitive abilities, and deposition of fibrillar amyloid proteins as intraneuronal neurofibrillary tangles, extracellular amyloid plaques and vascular amyloid deposits. The major constituent of these plaques is the neurotoxic amyloid-beta-APP 40-42 peptide (s), derived proteolytically from the transmembrane precursor protein APP by sequential secretase processing. The cytotoxic C-terminal fragments (CTFs) and the caspase-cleaved products such as C31 derived from APP, are also implicated in neuronal death.
    Defects in MT-ND1 may be associated with non-insulin-dependent diabetes mellitus (NIDDM).
  • Sequence similarities
    Belongs to the complex I subunit 1 family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab114460 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab114460 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114460.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up