Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGR GFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR
    • Amino acids
      291 to 390
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162153 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • [Acyl-carrier-protein] malonyltransferase
    • FabD
    • FABD_HUMAN
    • FASN 2C
    • FASN2C
    • Malonyl CoA acyl carrier protein transacylase
    • Malonyl CoA acyl carrier protein transacylase mitochondrial
    • Malonyl CoA:ACP acyltransferase
    • Malonyl CoA:ACP acyltransferase (mitochondrial)
    • Malonyl CoA:acyl carrier protein transacylase mitochondrial
    • Malonyl-CoA-acyl carrier protein transacylase
    • Mcat
    • MCT
    • MCT1
    • MGC47838
    • mitochondrial
    • Mitochondrial malonyl CoA:ACP acyltransferase
    • Mitochondrial malonyltransferase
    • NET62
    see all
  • Function
    Catalyzes the transfer of a malonyl moiety from malonyl-CoA to the free thiol group of the phosphopantetheine arm of the mitochondrial ACP protein (NDUFAB1). This suggests the existence of the biosynthesis of fatty acids in mitochondrias.
  • Pathway
    Lipid metabolism; fatty acid biosynthesis.
  • Sequence similarities
    Belongs to the type II malonyltransferase family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab162153 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162153 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162153.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up