Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LKMPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTR QAFFLHTTYFTKFARQVCKNTLRLRQAARRPFVAINYAAIRAECKMLLNS
    • Amino acids
      416 to 515
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153453 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1110002J22Rik
    • fj99h01
    • KIAA1266
    • Metastasis associated 1 family, member 3
    • Metastasis associated 3
    • Metastasis associated family, member 3
    • Metastasis associated gene 3
    • Metastasis associated gene family, member 3
    • Metastasis associated protein MTA3
    • Metastasis-associated protein MTA3
    • MGC56396
    • MGC77410
    • mKIAA1266
    • mta1
    • Mta3
    • MTA3 metastasis associated 1 family, member 3
    • Mta3 metastasis associated 3
    • MTA3_HUMAN
    • wu:fj99h01
    • zgc:56396
    see all
  • Function
    Plays a role in maintenance of the normal epithelial architecture through the repression of SNAI1 transcription in a histone deacetylase-dependent manner, and thus the regulation of E-cadherin levels.
  • Tissue specificity
    No expression in nonepithelial cells.
  • Sequence similarities
    Contains 1 BAH domain.
    Contains 1 ELM2 domain.
    Contains 1 GATA-type zinc finger.
    Contains 1 SANT domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153453 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153453 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153453.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up