Recombinant Human MTERFD3 protein (ab164243)

Overview

  • Product name
    Recombinant Human MTERFD3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLWKLLLRSQSCRLCSFRKMRSPPKYRPFLACFTYTTDKQSSKENTRTVE KLYKCSVDIRKIRRLKGWVLLEDETYVEEIANILQELGADETAVASILER CPEAIVCSPTAVNTQRKLWQLVCKNEEELIKLIEQFPESFFTIKDQENQK LNVQFFQELGLKNVVISRLLTAAPNVFHNPVEKNKQMVRILQESYLDVGG SEANMKVWLLKLLSQNPFILLNSPTAIKETLEFLQEQGFTSFEILQLLSK LKGFLFQLCPRSIQNSISFSKNAFKCTDHDLKQLVLKCPALLYYSVPVLE ERMQGLLREGISIAQIRETPMVLELTPQIVQYRIRKLNSSGYRIKDGHLA NLNGSKKEFEANFGKIQAKKVRPLFNPVAPLNVEE
    • Amino acids
      1 to 385
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164243 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Hypothetical protein DKFZp667I1824
    • mitochondrial
    • Mitochondrial transcription termination factor 2
    • Mitochondrial transcription termination factor-like protein
    • MTER3_HUMAN
    • MTERF domain containing 3
    • mTERF domain-containing protein 3
    • mTERF domain-containing protein 3, mitochondrial
    • mTERF2
    • Mterfd3
    • mTERFL
    • Transcription termination factor 2 mitochondrial
    • Transcription termination factor like protein
    see all
  • Function
    Binds promoter DNA and regulates mitochondrial transcription. Required for normal levels of transcription, both for mRNA and tRNA. Required for normal mitchondrial protein synthesis, assembly of respiratory complexes and normal mitochondrial function.
  • Tissue specificity
    Expressed in skeletal muscle, heart, liver and pancreas.
  • Sequence similarities
    Belongs to the mTERF family.
  • Cellular localization
    Mitochondrion. Mitochondrion matrix > mitochondrion nucleoid.
  • Information by UniProt

Images

  • ab164243 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164243 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164243.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up