Overview

  • Product name
    Recombinant Human MTF2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQ DVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGS GEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWL CRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQ QCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICS VCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENW DRLHPGELADTPKSERYEHVLEALNDYKTMEVSNGIEKKGKKKSVGRPPG PYTRKMIQKTAEPLLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFT GASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRA LQTQNSEIVKDDEGKEDYQFDELNTEILNNLADQELQLNHLKNSITSYFG AAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS
    • Amino acids
      1 to 536
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DJ976O13.2
    • hPCl2
    • M96
    • metal regulatory transcription factor 2
    • Metal response element binding transcription factor 2
    • metal-response element DNA-binding protein M96
    • PCL2
    • polycomb-like 2
    • polycomb-like protein 2
    • Putative DNA binding protein
    • RP5 976O13.1
    • RP5-976O13.1
    • TDRD19A
    • tudor domain containing 19A
    see all
  • Relevance
    Binds to the metal-regulating-element (MRE) of metallothionein gene promoter. May be involved in the activation of MT (metallothionein) genes in response to heavy-metal ions.
  • Cellular localization
    Nuclear

Images

  • ab161435 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161435 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up