Overview

  • Product nameRecombinant Human MTH1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP36639
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGASRLYTLVLVLQPQRVLLGMKKRGFGAG RWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPEL MDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQK KKFHGYFKFQGQDTILDYTLREVDTV
    • Molecular weight20 kDa including tags
    • Amino acids1 to 156
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99390 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab99390 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • 2-hydroxy-dATP diphosphatase
    • 7
    • 7 8 dihydro 8 oxoguanine triphosphatase
    • 8 oxo 7 8 dihydrodeoxyguanosine triphosphatase
    • 8 oxo 7 8 dihydroguanosine triphosphatase
    • 8 oxo dGTPase
    • 8-dihydro-8-oxoguanine triphosphatase
    • 8-oxo-dGTPase
    • 8ODP_HUMAN
    • MTH 1
    • MTH1
    • MutT human homolog 1
    • Nucleoside diphosphate linked moiety X motif 1
    • Nucleoside diphosphate linked moiety X type motif 1
    • Nucleoside diphosphate-linked moiety X motif 1
    • Nudix (nucleoside diphosphate linked moiety X) type motif 1
    • Nudix hydrolase 1
    • Nudix motif 1
    • Nudix type motif 1
    • NUDT 1
    • Nudt1
    see all
  • FunctionAntimutagenic. Acts as a sanitizing enzyme for oxidized nucleotide pools, thus suppressing cell dysfunction and death induced by oxidative stress. Hydrolyzes 8-oxo-dGTP, 8-oxo-dATP and 2-OH-dATP, thus preventing misincorporation of oxidized purine nucleoside triphosphates into DNA and subsequently preventing A:T to C:G and G:C to T:A transversions. Able to hydrolyze also the corresponding ribonucleotides, 2-OH-ATP, 8-oxo-GTP and 8-oxo-ATP. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA.
  • Tissue specificityWidely expressed with highest expression in thymus, testis, embryo and proliferating blood lymphocytes.
  • Sequence similaritiesBelongs to the Nudix hydrolase family.
    Contains 1 nudix hydrolase domain.
  • Developmental stageIn peripheral blood lymphocytes, expressed at much higher levels in proliferating cells than in resting cells.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localizationCytoplasm. Mitochondrion matrix and Cytoplasm. Mitochondrion matrix. Nucleus. Mostly present in cytoplasm. Variant Met-124 has decreased efficiency in translocation to mitochondria.
  • Information by UniProt

Recombinant Human MTH1 protein images

  • 15% SDS-PAGE analysis of 3µg ab99390.

References for Recombinant Human MTH1 protein (ab99390)

ab99390 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99390.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"