Recombinant Human MTHFD1 protein (ab116852)

Overview

  • Product name
    Recombinant Human MTHFD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAPAEILNGKEISAQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSN LYINVKLKAAEEIGIKATHIKLPRTTTESEVMKYITSLNEDSTVHGFLVQ LPLDSENSINTEEVINAIAPEKDVDGLTSINAGRLARGDLNDCFIPCTPK GCLELIKETGVPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTA HLDEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGINYVPDDKKPNGR KVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRFLEKFKP GKWMIQYNNLNLKTPVPSDIDISRSCKPKPIGKLAREIGLLSEEVELYGE TKAKVLLSALERLKHRPDGKYVVVTGITPTPLGEGKSTTTIGLVQALGAH LYQNVFACVRQPSQGPTFGIKGGAAGGGYSQVIPMEEFNLHLTGDIHAIT AANNLVAAAIDARIFHELTQTDKALFNRLVPSVNGVRRFSDIQIRRLKRL GIEKTDPTTLTDEEINRFARLDIDPETITWQRVLDTNDRFLRKITIGQAP TEKGHTRTAQFDISVASEIMAVLALTTSLEDMRERLGKMVVASSKKGEPV SAEDLGVSGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSII ADQIALKLVGPEGFVVTEAGFGADIGMEKFFNIKCRYSGLCPHVVVLVAT VRALKMHGGGPTVTAGLPLPKAYIQENLELVEKGFSNLKKQIENARMFGI PVVVAVNAFKTDTESELDLISRLSREHGAFDAVKCTHWAEGGKGALALAQ AVQRAAQAPSSFQLLYDLKLPVEDKIRIIAQKIYGADDIELLPEAQHKAE VYTKQGFGNLPICMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFL YPLVGTMSTMPGLPTRPCFYDIDLDPETEQVNGLF
    • Molecular weight
      129 kDa including tags
    • Amino acids
      1 to 935

Specifications

Our Abpromise guarantee covers the use of ab116852 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5,10 methylenetetrahydrofolate dehydrogenase 5,10 methylenetetrahydrofolate cyclohydrolase,10 formyltetrahydrofolate synthetase
    • C 1 tetrahydrofolate synthase cytoplasmic
    • C1 tetrahydrofolate synthase cytoplasmic
    • C1 THF synthase
    • C1-THF synthase
    • C1TC
    • C1TC_HUMAN
    • Cytoplasmic C 1 tetrahydrofolate synthase
    • Formyltetrahydrofolate synthetase
    • Methenyltetrahydrofolate cyclohydrolase
    • Methylenetetrahydrofolate dehydrogenase
    • Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) methenyltetrahydrofolate cyclohydrolase formyltetrahydrofolate synthetase
    • Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1 methenyltetrahydrofolate cyclohydrolase formyltetrahydrofolate synthetase
    • MTHFC
    • MTHFD
    • MTHFD1
    • NADP dependent cyclohydrolase formyltetrahydrofolate synthetase
    • OTTHUMP00000180657
    see all
  • Tissue specificity
    Ubiquitous.
  • Pathway
    One-carbon metabolism; tetrahydrofolate interconversion.
  • Involvement in disease
    Defects in MTHFD1 may be a cause of susceptibility to folate-sensitive neural tube defects (folate-sensitive NTD) [MIM:601634]. The most common NTDs are open spina bifida (myelomeningocele) and anencephaly. Genetic defects in MTHFD1 may affect the risk of spina bifida via the maternal rather than the embryonic genotype.
    Genetic variation in MTHFD1 could be associated with susceptibility to colorectal cancer (CRC) [MIM:114500].
  • Sequence similarities
    In the N-terminal section; belongs to the tetrahydrofolate dehydrogenase/cyclohydrolase family.
    In the C-terminal section; belongs to the formate--tetrahydrofolate ligase family.
  • Domain
    This trifunctional enzyme consists of two major domains: an N-terminal part containing the methylene-THF dehydrogenase and cyclohydrolase activities and a larger C-terminal part containing formyl-THF synthetase activity.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116852 at approximately 128.59kDa; stained with Coomassie Blue.

References

ab116852 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116852.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up