Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP49914
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAAAAVSSAKRSLRGELKQRLRAMSAEERL RQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFI PRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLD LIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQIC LQVPVNENDMKVDEVLYEDSSTA
    • Molecular weight25 kDa including tags
    • Amino acids1 to 203
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104635 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab104635 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • 10-methenyl-tetrahydrofolate synthetase
    • 5
    • 5 10 methenyl tetrahydrofolate synthetase
    • 5 formyltetrahydrofolate cyclo ligase
    • 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase)
    • 5-formyltetrahydrofolate cyclo-ligase
    • FLJ30410
    • HsT19268
    • Methenyl THF synthetase
    • Methenyl-THF synthetase
    • Mthfs
    • MTHFS_HUMAN
    see all
  • FunctionContributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. Catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-FTHF) to yield 5,10-methenyltetrahydrofolate.
  • Sequence similaritiesBelongs to the 5-formyltetrahydrofolate cyclo-ligase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human MTHFS protein images

  • 15% SDS-PAGE analysis of 3µg ab104635.

References for Recombinant Human MTHFS protein (ab104635)

ab104635 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104635.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"