Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAAAAVSSAKRSLRGELKQRLRAMSAEERL RQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFI PRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLD LIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQIC LQVPVNENDMKVDEVLYEDSSTA
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 203
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab124855 is purified by proprietary chromatographic techniques and sterile filtered.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.08% DTT, 0.32% Tris HCl, 30% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • 10-methenyl-tetrahydrofolate synthetase
    • 5
    • 5 10 methenyl tetrahydrofolate synthetase
    • 5 formyltetrahydrofolate cyclo ligase
    • 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase)
    • 5-formyltetrahydrofolate cyclo-ligase
    • FLJ30410
    • HsT19268
    • Methenyl THF synthetase
    • Methenyl-THF synthetase
    • MTHFS
    • MTHFS_HUMAN
    see all
  • Function
    Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. Catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-FTHF) to yield 5,10-methenyltetrahydrofolate.
  • Sequence similarities
    Belongs to the 5-formyltetrahydrofolate cyclo-ligase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab124855 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab124855.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up