Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP49914
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAAAAVSSAKRSLRGELKQRLRAMSAEERL RQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFI PRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLD LIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQIC LQVPVNENDMKVDEVLYEDSSTA
    • Molecular weight25 kDa including tags
    • Amino acids1 to 203
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab124855 is purified by proprietary chromatographic techniques and sterile filtered.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.08% DTT, 0.32% Tris HCl, 30% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • 10-methenyl-tetrahydrofolate synthetase
    • 5
    • 5 10 methenyl tetrahydrofolate synthetase
    • 5 formyltetrahydrofolate cyclo ligase
    • 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase)
    • 5-formyltetrahydrofolate cyclo-ligase
    • FLJ30410
    • HsT19268
    • Methenyl THF synthetase
    • Methenyl-THF synthetase
    • MTHFS
    • MTHFS_HUMAN
    see all
  • FunctionContributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. Catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-FTHF) to yield 5,10-methenyltetrahydrofolate.
  • Sequence similaritiesBelongs to the 5-formyltetrahydrofolate cyclo-ligase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

References for Recombinant Human MTHFS protein (ab124855)

ab124855 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124855.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"