Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLSLPAPLRVNRGLWQLCTGAGLWLLQGALPVTRSWAV
    • Amino acids
      1 to 38
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160178 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MTMR 1
    • Myotubularin related 1
    • Myotubularin related protein 1
  • Relevance
    MTMR1 is a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. The MTMR1 gene shares structural similarities with the MTM1 gene, and is also located in the same chromosomal region. Myotubularin related proteins are a large subfamily of protein tyrosine phosphatases (PTPs) that dephosphorylate D3 phosphorylated inositol lipids. MTMR1 is a lipid phosphatase that acts on phosphatidylinositol 3-phosphate and phosphatidylinositol (3,5)-bisphosphate.
  • Cellular localization
    Plasma Membrane; Peripheral membrane protein, cytoplasmic side.

Images

  • ab160178 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160178 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160178.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up