Recombinant Human MTMR12 protein (ab162776)

Overview

  • Product name
    Recombinant Human MTMR12 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PEAQILGGGQVATLSKLLEMMEEVQSLQEKIDERHHSQQAPQAEAPCLLR NSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGDV
    • Amino acids
      648 to 747
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 PAP
    • 3 phosphatase adapter protein
    • 3 phosphatase adapter subunit
    • 3-PAP
    • 3-phosphatase adapter protein
    • 3PAP
    • KIAA1682
    • Mtmr12
    • MTMRC_HUMAN
    • Myotubularin related protein 12
    • Myotubularin-related protein 12
    • Phosphatidylinositol 3 phosphate 3 phosphatase adapter subunit
    • Phosphatidylinositol 3 phosphate 3-phosphatase adapter subunit
    • Phosphatidylinositol 3 phosphate associated protein
    • PIP3AP
    see all
  • Function
    Catalytically inactive phosphatase that plays a role as an adapter for the phosphatase myotubularin to regulate myotubularin intracellular location.
  • Tissue specificity
    Ubiquitous with prominent expression in brain, heart, kidney, placenta, and lung.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class myotubularin subfamily.
    Contains 1 myotubularin phosphatase domain.
  • Cellular localization
    Cytoplasm. Localizes to punctate vesicles when associated with MTM1.
  • Information by UniProt

Images

  • ab162776 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162776 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up