Overview

  • Product name
    Recombinant Human MTSS1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GVLPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPG PKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQ
    • Amino acids
      346 to 445
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160652 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2310003N14Rik
    • BC024131
    • D130001D01Rik
    • DKFZp781P2223
    • FLJ44694
    • KIAA0429
    • metastasis suppressor 1
    • Metastasis suppressor protein 1
    • Metastasis suppressor YGL 1
    • Metastasis suppressor YGL-1
    • MGC37896
    • MIM
    • MIMA
    • MIMB
    • missing in metastasis
    • Missing in metastasis protein
    • mKIAA0429
    • MTSS 1
    • Mtss1
    • MTSS1_HUMAN
    see all
  • Function
    May be related to cancer progression or tumor metastasis in a variety of organ sites, most likely through an interaction with the actin cytoskeleton.
  • Tissue specificity
    Expressed in many tissues, including spleen, thymus, prostate, testis, uterus, colon, and peripheral blood.
  • Sequence similarities
    Belongs to the MTSS1 family.
    Contains 1 IMD (IRSp53/MIM homology) domain.
    Contains 1 WH2 domain.
  • Domain
    The WH2 motif at the C-terminus binds to actin monomers.
  • Cellular localization
    Cytoplasm, cytoskeleton.
  • Information by UniProt

Images

  • ab160652 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160652 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160652.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up