Overview

  • Product name
    Recombinant Human MTUS1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQLQEQFDNLNAAHETSKLEIEASHSEKLELLTKAYEASLSEIKKGHEIE KKSLEDLLSEKQESLEKQINDLKSENDALNEKLKSEEQKRRAREKANLKN PQIMYLEQELESLKAVLEIKNEKLHQQDIKLMKMGKLVDNNTALVDKLKR FQQENEELKARMDKHMAISRQLSTEQAVLQESLEKESKVNKRLSMENEEL LWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR
    • Amino acids
      1 to 240
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163572 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AGTR2-interacting protein
    • Angiotensin II type 2 receptor interacting protein
    • AT2 receptor interacting protein
    • AT2 receptor-binding protein
    • AT2R binding protein
    • ATBP
    • ATIP
    • ATIP1
    • DKFZp586D1519
    • DKFZp686F20243
    • Erythroid differentiation related
    • FLJ14295
    • GK 1
    • GK1
    • KIAA1288
    • Microtubule associated tumor suppressor 1
    • Mitochondrial tumor suppressor 1
    • Mitochondrial tumor suppressor gene 1
    • MP 44
    • MP44
    • MTSG 1
    • MTSG1
    • MTUS 1
    • Transcription factor MTSG1
    see all
  • Relevance
    Multiple alternatively spliced transcript variants encoding different isoforms have been found for the MTUS1 (Mitochondrial tumor suppressor 1) gene. One of the transcript variants has been shown to encode a mitochondrial protein that acts as a tumor suppressor and cooperates with the angiotension II (AT2) receptor (AGTR2) to inhibit ERK2 activation and cell proliferation. MTUS1 polypeptides are identical in their carboxy-terminal region carrying four coiled-coil domains. In their amino-terminal portion, MTUS1 polypeptides exhibit distinct motifs for localisation in the cytosol, nucleus or cell membrane, suggesting that MTUS1 gene products may be involved in a variety of intracellular functions in an AT2-dependent and independent manner.
  • Cellular localization
    Cell Membrane, Golgi Apparatus, Mitochondrial and Nuclear. Note=In neurons, translocates into the nucleus after treatment with angiotensin-II.

Images

  • ab163572 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163572 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163572.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up