Overview

  • Product name
    Recombinant Human MTUS2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGHCCCKPYNCLQCLDKTNESALVKEKELSIELANIRDEVAFHTAKCEKL QKEKEELERRFEDEVKRLGWQQQAELQELEERLQLQFEAEMARLQEEHGD QLLSIRCQHQEQVEDLTASHDAALLEMENNHTVAITILQDDHDHKVQELM STHELEKKELEENFEKLRLSLQDQVDTLTFQSQSLRDRARRFEEALRKNT EEQLEIALAPYQHLEEDMKSLKQVLEMKNQQIHEQEKKILELEKLAEKNI ILEEKIQVLQQQNEDLKARIDQNTVVTRQLSEENANLQEYVEKETQEKKR LSRTNEELLWKLQTGDPTSPIKLSPTSPVYRGSSSGPSSPARVSTTPR
    • Amino acids
      1 to 348
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161585 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • +TIP of 150 kDa
    • 5730592G18Rik
    • A730013O20Rik
    • AU067634
    • C130038G02Rik
    • Cardiac zipper protein
    • CAZIP
    • Gm763
    • KIAA0774
    • Microtubule plus-end tracking protein TIP150
    • Microtubule-associated tumor suppressor candidate 2
    • mKIAA0774
    • Mtus2
    • MTUS2_HUMAN
    • OTTHUMP00000018187
    • OTTHUMP00000018188
    • RP11-274A8.2
    • TIP150
    • Tracking protein of 150 kDa
    see all
  • Function
    Binds microtubules. Together with MAPRE1 may target the microtubule depolymerase KIF2C to the plus-end of microtubules. May regulate the dynamics of microtubules at their growing distal tip.
  • Tissue specificity
    Detected in embryonic stem cells differentiating to cardiomyocytes.
  • Sequence similarities
    In the C-terminal section; belongs to the MTUS1 family.
  • Cellular localization
    Cytoplasm > cytoskeleton. Associated with the microtubule network at the growing distal tip (the plus-end) of microtubules.
  • Information by UniProt

Images

  • ab161585 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161585 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161585.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up