Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VSRTEVMPSSRTSIPGPAQSTMSLDISDEVVTRLSTSPIMTESAEITITT QTGYSLATSQVTLPLGTSMTFLSGTHSTMSQGLSHSEMTNLMSRG
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1321 to 1415
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CA 125
    • CA-125
    • CA125
    • CA125 ovarian cancer antigen
    • Cancer antigen 125
    • FLJ14303
    • MUC 16
    • MUC-16
    • MUC16
    • MUC16_HUMAN
    • Mucin 16
    • Mucin 16 cell surface associated
    • Mucin-16
    • Mucin16
    • Ovarian cancer related tumor marker CA125
    • Ovarian cancer-related tumor marker CA125
    • Ovarian carcinoma antigen CA125
    see all
  • Function
    Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
  • Tissue specificity
    Expressed in corneal and conjunctival epithelia (at protein level). Overexpressed in ovarian carcinomas and ovarian low malignant potential (LMP) tumors as compared to the expression in normal ovarian tissue and ovarian adenomas.
  • Sequence similarities
    Contains 2 ANK repeats.
    Contains 56 SEA domains.
  • Domain
    Composed of three domains, a Ser-, Thr-rich N-terminal domain, a repeated domain containing more than 60 partially conserved tandem repeats of 156 amino acids each (AAs 12061-21862) and a C-terminal transmembrane contain domain with a short cytoplasmic tail.
  • Post-translational
    modifications
    Heavily O-glycosylated; expresses both type 1 and type 2 core glycans.
    Heavily N-glycosylated; expresses primarily high mannose and complex bisecting type N-linked glycans.
    May be phosphorylated. Phosphorylation of the intracellular C-terminal domain may induce proteolytic cleavage and the liberation of the extracellular domain into the extracellular space.
    May contain numerous disulfide bridges. Association of several molecules of the secreted form may occur through interchain disulfide bridges providing an extraordinarily large gel-like matrix in the extracellular space or in the lumen of secretory ducts.
  • Cellular localization
    Cell membrane. Secreted > extracellular space. May be liberated into the extracellular space following the phosphorylation of the intracellular C-terminus which induces the proteolytic cleavage and liberation of the extracellular domain.
  • Information by UniProt

Images

  • ab164957 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164957 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up