Overview

  • Product name
    Recombinant Human MUC20 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGCLWGLALPLFFFCWEVGVSGSSAGPSTRRADTAMTTDDTEVPAMTLAP GHAALETQTLSAETSSRASTPAGPIPEAETRGAKRISPARETRSFTKTSP NFMVLIATSVETSAASGSPEGAGMTTVQTITGSDPEEAIFDTLCTDDSSE EAKTLTMDILTLAHTSTEAKGLSSESSASSDGPHPVITPSRASESSASSD GPHPVITPSRASESSASSDGPHPVITPSWSPGSDVTLLAEALVTVTNIEV INCSITEIETTTSSIPGASDIDLIPTEGVKASSTSDPPALPDSTEAKPHI TEVTASAETLSTAGTTESAAPHATVGTPLPTNSATEREVTAPGATTLSGA LVTVSRNPLEETSALSVETPSYVKVSGAAPVSIEAGSAVGKTTSFAGSSA SSYSPSEAALKNFTPSETPTMDIATKGPFPTSRDPLPSVPPTTTNSSRGT NSTLAKITTSAKTTMKPPTATPTTARTRPTTDVSAGENGGFLLLRLSVAS PEDLTDPRVAERLMQQLHRELHAHAPHFQVSLLRVRRG
    • Amino acids
      1 to 538
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165875 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MUC 20
    • MUC-20
    • Muc20
    • MUC20_HUMAN
    • Mucin 20
    • Mucin 20, cell surface associated
    • Mucin-20
    • Transmembrane mucin MUC20S
    see all
  • Function
    May regulate MET signaling cascade. Seems to decrease hepatocyte growth factor (HGF)-induced transient MAPK activation. Blocks GRB2 recruitment to MET thus suppressing the GRB2-RAS pathway. Inhibits HGF-induced proliferation of MMP1 and MMP9 expression.
  • Tissue specificity
    Highly expressed in kidney, moderately in placenta, lung, prostate, liver, and digestive system. In the kidney, localized in the proximal tubules but not in the glomerulus or distal tubules. Detected in most of the male urogenital tract epithelia, with the exception of epididymis.
  • Cellular localization
    Secreted. Apical cell membrane. Basolateral cell membrane. Cell projection > microvillus membrane.
  • Information by UniProt

Images

  • ab165875 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165875 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165875.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up