Overview

  • Product name
    Recombinant Human MUC5B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQC TCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTR GFPAQEATAV
    • Amino acids
      4186 to 4295
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes

    The protein sequence corresponds to Human MUC5B partial ORF ( XP_039877.9, 4186 a.a. - 4295 a.a.)
    and aa 5653-5762 on Uniprot Q9HC84 (http://www.uniprot.org/uniprot/Q9HC84).

     

    Protein concentration is above or equal to 0.05 mg/ml.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2300002I04Rik
    • A130042M24
    • AV085033
    • Cervical mucin
    • Cervical mucin MUC5B
    • High molecular weight salivary mucin MG1
    • MG1
    • MUC-5B
    • MUC5
    • MUC5B
    • MUC5B_HUMAN
    • MUC9
    • Mucin 5 subtype B, tracheobronchial
    • Mucin 5B
    • Mucin 5B oligomeric mucus/gel forming
    • Mucin-5 subtype B
    • Mucin-5B
    • Sublingual gland mucin
    • tracheobronchial
    see all
  • Function
    Gel-forming mucin that is thought to contribute to the lubricating and viscoelastic properties of whole saliva and cervical mucus.
  • Tissue specificity
    Expressed on surface airway epithelia. Expressed mainly in mucous cells of submucosal glands of airway tissues. Highly expressed in the sublingual gland. Also found in submaxillary glands, endocervix, gall bladder, and pancreas.
  • Sequence similarities
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 3 HAT repeats.
    Contains 3 TIL (trypsin inhibitory-like) domains.
    Contains 3 VWFC domains.
    Contains 4 VWFD domains.
  • Domain
    The cysteine residues in the Cys-rich subdomain repeats are not involved in disulfide bonding.
  • Post-translational
    modifications
    Highly glycosylated. C-, N- and O-glycosylated. C-mannosylated in the Cys-rich subdomains probably on the first Trp residue of the WXXW motif. Highly O-glycosylated in the Ser/Thr-rich tandem repeat (TR) region. The repeat region is about 59% O-glycosylated with a high abundance of NeuAc(2)Hex(1)HexNac1-ol.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab153651 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153651 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up