Recombinant Human Mucin 5AC protein (ab114218)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP98088
    • SpeciesHuman
    • SequenceNQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEH RCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH
    • Molecular weight37 kDa including tags
    • Amino acids351 to 450

Specifications

Our Abpromise guarantee covers the use of ab114218 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Apomucin
    • Apomucin Major Airway Glycoprotein
    • Gastric mucin
    • LeB
    • Lewis B blood group antigen
    • Major Airway Glycoprotein
    • MUC 5
    • MUC5
    • MUC5AC
    • Mucin 5 subtype AC tracheobronchial
    • Mucin 5 Subtypes A And C
    • Mucin 5 subtypes A and C tracheobronchial/gastric
    • Mucin 5, tracheobronchial/gastric
    • Mucin 5AC
    • Mucin 5AC oligomeric mucus/gel forming
    • Mucin 5AC, oligomeric mucus/gel forming pseudogene
    • TBM
    • Tracheobronchial mucin
    • Tracheobronchial Mucin (TBM)
    see all
  • RelevanceMucins are high molecular weight glycoproteins with 80% carbohydrates and 20% core protein. Gastric Mucin 5AC antigen is found in columnar mucus cells of surface gastric epithelium and in goblet cells of the fetal and precancerous colon but not in normal colon. Resurgence of gastric mucin during colonic carcinogenesis is suggestive of either re-expression of the peptide core of gastric mucin in the adult colon or due to changes in the glycosylation pattern of mucin, which expose the hidden Mucin 5AC antigen.
  • Cellular localizationSecreted; Cytoplasmic and cell surface

Recombinant Human Mucin 5AC protein images

  • ab114218 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Mucin 5AC protein (ab114218)

ab114218 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114218.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"