Recombinant Human Munc18-1 protein (ab114603)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP61764
    • SpeciesHuman
    • SequenceVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRA AKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPI
    • Molecular weight36 kDa including tags
    • Amino acids74 to 168

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ37475
    • Munc 18 1
    • Munc 18a
    • MUNC18 1
    • N-Sec1
    • Neuronal SEC1
    • NSec1
    • p67
    • Protein unc-18 homolog 1
    • Protein unc-18 homolog A
    • Rb sec1
    • RBSEC1
    • STXB1_HUMAN
    • STXBP1
    • Syntaxin binding protein 1
    • Syntaxin-binding protein 1
    • Unc 18 homolog
    • Unc 18A
    • Unc-18A
    • UNC18
    • Unc18 1
    • Unc18-1
    see all
  • FunctionMay participate in the regulation of synaptic vesicle docking and fusion, possibly through interaction with GTP-binding proteins. Essential for neurotransmission and binds syntaxin, a component of the synaptic vesicle fusion machinery probably in a 1:1 ratio. Can interact with syntaxins 1, 2, and 3 but not syntaxin 4. May play a role in determining the specificity of intracellular fusion reactions.
  • Tissue specificityBrain and spinal cord. Highly enriched in axons.
  • Involvement in diseaseDefects in STXBP1 are the cause of epileptic encephalopathy early infantile type 4 (EIEE4) [MIM:612164]. Affected individuals have neonatal or infantile onset of seizures, suppression-burst pattern on EEG, profound mental retardation, and MRI evidence of hypomyelination.
  • Sequence similaritiesBelongs to the STXBP/unc-18/SEC1 family.
  • Cellular localizationCytoplasm. Membrane.
  • Information by UniProt

Recombinant Human Munc18-1 protein images

  • ab114603 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Munc18-1 protein (ab114603)

ab114603 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"