Recombinant Human Munc18-1 protein (ab114603)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRA AKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPI
    • Molecular weight
      36 kDa including tags
    • Amino acids
      74 to 168

Specifications

Our Abpromise guarantee covers the use of ab114603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ37475
    • Munc 18 1
    • Munc 18a
    • MUNC18 1
    • N-Sec1
    • Neuronal SEC1
    • NSec1
    • p67
    • Protein unc-18 homolog 1
    • Protein unc-18 homolog A
    • Rb sec1
    • RBSEC1
    • STXB1_HUMAN
    • STXBP1
    • Syntaxin binding protein 1
    • Syntaxin-binding protein 1
    • Unc 18 homolog
    • Unc 18A
    • Unc-18A
    • UNC18
    • Unc18 1
    • Unc18-1
    see all
  • Function
    May participate in the regulation of synaptic vesicle docking and fusion, possibly through interaction with GTP-binding proteins. Essential for neurotransmission and binds syntaxin, a component of the synaptic vesicle fusion machinery probably in a 1:1 ratio. Can interact with syntaxins 1, 2, and 3 but not syntaxin 4. May play a role in determining the specificity of intracellular fusion reactions.
  • Tissue specificity
    Brain and spinal cord. Highly enriched in axons.
  • Involvement in disease
    Defects in STXBP1 are the cause of epileptic encephalopathy early infantile type 4 (EIEE4) [MIM:612164]. Affected individuals have neonatal or infantile onset of seizures, suppression-burst pattern on EEG, profound mental retardation, and MRI evidence of hypomyelination.
  • Sequence similarities
    Belongs to the STXBP/unc-18/SEC1 family.
  • Cellular localization
    Cytoplasm. Membrane.
  • Information by UniProt

Images

  • ab114603 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114603 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up